PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G172700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family LBD
Protein Properties Length: 163aa    MW: 17825.3 Da    PI: 8.3802
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G172700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601482.5e-46131121100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l++
  Aqcoe1G172700.1.p  13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQELPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDLLQT 104
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +la +++e
  Aqcoe1G172700.1.p 105 QLAIAQAE 112
                        ***99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.07812113IPR004883Lateral organ boundaries, LOB
PfamPF031957.0E-4613110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MKENGRKQGA TSPCAACKLL RRRCAQDCVF APYFPADEPQ KFANVHKVFG ASNVNKMLQE  60
LPEHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID LLQTQLAIAQ AEVVHMRMRQ  120
TASMSSLAVN SNNNVSPSSK LTTPHTKSFF SMDIDGESLW SC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274089.19e-99PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE91e-75LBD4_ARATH; LOB domain-containing protein 4
TrEMBLK4D8L72e-93K4D8L7_SOLLC; Uncharacterized protein
STRINGSolyc11g045530.1.17e-93(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.13e-65LOB domain-containing protein 4